DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:61 Identity:20/61 - (32%)
Similarity:27/61 - (44%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 REQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            |:..::.:.||....:.|.|......|:||.....|..|||..|.||.|.|.:|..|...|
Mouse    85 RKCLDLSEDICSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 17/49 (35%)
Wfdc6bXP_006499938.1 WAP <63..89 CDD:459672 1/3 (33%)
Kunitz_eppin 93..149 CDD:438654 19/53 (36%)

Return to query results.
Submit another query.