powered by:
Protein Alignment CG42827 and CG17380
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_651145.2 |
Gene: | CG17380 / 42766 |
FlyBaseID: | FBgn0039077 |
Length: | 119 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 21/56 - (37%) |
Similarity: | 31/56 - (55%) |
Gaps: | 0/56 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 IRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
:|.:.|...:..|.|||..:::.|:...:.|..|||..||||.|.|.||:.|:..|
Fly 20 LRHERCSFIANPGPCKGNFEMFAYDMDNNVCVEFIYGGCGGNPNRFQTKKECILLC 75
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10083 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.