DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and CG14298

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster


Alignment Length:36 Identity:15/36 - (41%)
Similarity:21/36 - (58%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCG 92
            |:::  |..|:.|.|..|.||.|.|.::|||...||
  Fly    77 WYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARCG 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 13/33 (39%)
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 13/33 (39%)

Return to query results.
Submit another query.