DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and wfikkn1

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_999912.1 Gene:wfikkn1 / 406570 ZFINID:ZDB-GENE-040426-2465 Length:558 Species:Danio rerio


Alignment Length:52 Identity:18/52 - (34%)
Similarity:26/52 - (50%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            :|...:..|.|:..:..||||....:|:.|:|..|.||.|.|.|:..|...|
Zfish   370 VCSLPAVQGPCRHWQARWFYNSLTERCEAFLYGGCSGNKNSFGTRRECDAHC 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 18/52 (35%)
wfikkn1NP_999912.1 WAP 27..73 CDD:278522
KAZAL_FS 124..160 CDD:238052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..194
I-set 199..287 CDD:254352
Ig 207..287 CDD:299845
Kunitz_BPTI 314..364 CDD:278443
Kunitz_BPTI 370..421 CDD:278443 17/50 (34%)
NTR_WFIKKN 439..547 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.