DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and spint1a

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_073783238.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:57 Identity:22/57 - (38%)
Similarity:30/57 - (52%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            ::.|..|::....|.|.|.:..|:|||.|..|..|.|..|.||.|.|.|:..|:.||
Zfish   379 DVSKARCVKPPVTGTCPGSQTKWYYNPNKRLCYRFNYGGCEGNQNRFETEAGCMTFC 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 19/49 (39%)
spint1aXP_073783238.1 None

Return to query results.
Submit another query.