DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and ambp

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:65 Identity:25/65 - (38%)
Similarity:32/65 - (49%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KKICLQS----------SEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCG 92
            :|.||||          .:.|.||....||.::....||....|..|.||||.||:|:.|.|:||
Zfish   268 EKDCLQSCRTEAACRLPMDAGPCKAFVDLWAFDSSSGKCLSLKYGGCKGNGNRFYSKKECDEYCG 332

  Fly    93  92
            Zfish   333  332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 22/59 (37%)
ambpNP_957412.2 lipocalin_A1M-like 24..186 CDD:381193
Kunitz_bikunin_1-like 223..276 CDD:438639 5/7 (71%)
Kunitz_bikunin_2-like 278..332 CDD:438640 18/53 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.