powered by:
Protein Alignment CG42827 and Y57E12AR.1
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033516.1 |
Gene: | Y57E12AR.1 / 3896861 |
WormBaseID: | WBGene00044612 |
Length: | 99 |
Species: | Caenorhabditis elegans |
Alignment Length: | 35 |
Identity: | 11/35 - (31%) |
Similarity: | 18/35 - (51%) |
Gaps: | 0/35 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 WFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
::::....:|..|....||||.|.|..:..|.:||
Worm 59 YYFDVATQECYPFGVQKCGGNQNQFNNRSECQQFC 93
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42827 | NP_651142.3 |
KU |
40..92 |
CDD:238057 |
11/35 (31%) |
Y57E12AR.1 | NP_001033516.1 |
KU |
34..93 |
CDD:197529 |
9/33 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.