DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and tfpia

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001296732.1 Gene:tfpia / 359833 ZFINID:ZDB-GENE-030711-1 Length:279 Species:Danio rerio


Alignment Length:64 Identity:24/64 - (37%)
Similarity:39/64 - (60%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGK--YDWKKVR 100
            ::|:.:.:.|.|.|..:.:.:||:..:||||.||.||||.|.|..|..|::.|.|  :..|::|
Zfish   203 ELCMSAVDRGDCDGSERRYVFNPRIGRCQVFRYSGCGGNKNNFIHKRHCMKMCMKDQHRRKQIR 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 20/51 (39%)
tfpiaNP_001296732.1 Kunitz_BPTI 42..92 CDD:278443
KU 99..151 CDD:238057
Kunitz_BPTI 205..256 CDD:278443 20/50 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11029
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.