DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and CG2816

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:54 Identity:27/54 - (50%)
Similarity:32/54 - (59%) Gaps:1/54 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEF 90
            |.|:|||....|:|.|..:.:.|||.|..|:.|||..||||.|.|.||..| ||
  Fly    27 RVKLCLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAEC-EF 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 25/50 (50%)
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 25/51 (49%)

Return to query results.
Submit another query.