DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and APLP2

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001633.1 Gene:APLP2 / 334 HGNCID:598 Length:763 Species:Homo sapiens


Alignment Length:91 Identity:24/91 - (26%)
Similarity:38/91 - (41%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSDSLQEQYEREQYNIR--------------------KKICLQSSEYGKCKGRRKLWFYNPKKSK 65
            |.|...:.::.:.||..                    |.:|.|.:..|.|:.....|:::..|.|
Human   270 DRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGK 334

  Fly    66 CQVFIYSNCGGNGNLFYTKESCVEFC 91
            |..|||..||||.|.|.:::.|:..|
Human   335 CVRFIYGGCGGNRNNFESEDYCMAVC 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 19/52 (37%)
APLP2NP_001633.1 A4_EXTRA 42..204 CDD:128326
GFLD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 46..139
APP_N 49..147 CDD:280358
CuBD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 147..205
APP_Cu_bd 149..204 CDD:289676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..299 4/28 (14%)
Kunitz_BPTI 309..361 CDD:278443 19/52 (37%)
APP_E2 365..547 CDD:289677
APP_amyloid 709..759 CDD:287486
Interaction with DAB2. /evidence=ECO:0000250 749..763
NPXY motif 750..755
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.