DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and hhip

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001073481.1 Gene:hhip / 326102 ZFINID:ZDB-GENE-030131-4827 Length:693 Species:Danio rerio


Alignment Length:91 Identity:22/91 - (24%)
Similarity:35/91 - (38%) Gaps:24/91 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQSSEYGKCKGRRKLWFYNPKKSK---------------CQVFIYSNCGGNGNLFYTKESCVEFC 91
            |:..:...|....::.|::||..|               ||.|.|:..|....||  :....|||
Zfish   103 LEEIKCAHCSPNAQMLFHSPKLEKAPHREQDLPHLCHDYCQEFYYTCRGHVPELF--QADVDEFC 165

  Fly    92 ---GKYD----WKKVRKTGLRRSADY 110
               |:.|    :....:..|||.::|
Zfish   166 QYYGRMDGGLCFPDFHRKQLRRDSNY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 16/67 (24%)
hhipNP_001073481.1 Folate_rec 36..212 CDD:281076 22/91 (24%)
GSDH 218..>420 CDD:285269
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.