powered by:
Protein Alignment CG42827 and wu:fb59d01
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373281.1 |
Gene: | wu:fb59d01 / 322379 |
ZFINID: | ZDB-GENE-030131-1098 |
Length: | 211 |
Species: | Danio rerio |
Alignment Length: | 75 |
Identity: | 23/75 - (30%) |
Similarity: | 35/75 - (46%) |
Gaps: | 6/75 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGL 104
||....:.|.|.....:::||.::..|::|||..|.||.|.|.::|.|.:.| ..|...|
Zfish 92 ICSMEMDEGTCFALFPMYYYNAEEKICRMFIYRGCRGNANRFESREECQQTC------LARSGRL 150
Fly 105 RRSADYRRKD 114
..:||....|
Zfish 151 MGAADLPNPD 160
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.