DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and wu:fb59d01

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001373281.1 Gene:wu:fb59d01 / 322379 ZFINID:ZDB-GENE-030131-1098 Length:211 Species:Danio rerio


Alignment Length:75 Identity:23/75 - (30%)
Similarity:35/75 - (46%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGL 104
            ||....:.|.|.....:::||.::..|::|||..|.||.|.|.::|.|.:.|      ..|...|
Zfish    92 ICSMEMDEGTCFALFPMYYYNAEEKICRMFIYRGCRGNANRFESREECQQTC------LARSGRL 150

  Fly   105 RRSADYRRKD 114
            ..:||....|
Zfish   151 MGAADLPNPD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 17/51 (33%)
wu:fb59d01NP_001373281.1 Kunitz_BPTI 27..77 CDD:394972
Kunitz_BPTI 92..143 CDD:394972 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.