DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and tfpil

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001373281.1 Gene:tfpil / 322379 ZFINID:ZDB-GENE-030131-1098 Length:211 Species:Danio rerio


Alignment Length:75 Identity:23/75 - (30%)
Similarity:35/75 - (46%) Gaps:6/75 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGL 104
            ||....:.|.|.....:::||.::..|::|||..|.||.|.|.::|.|.:.|      ..|...|
Zfish    92 ICSMEMDEGTCFALFPMYYYNAEEKICRMFIYRGCRGNANRFESREECQQTC------LARSGRL 150

  Fly   105 RRSADYRRKD 114
            ..:||....|
Zfish   151 MGAADLPNPD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 16/49 (33%)
tfpilNP_001373281.1 Kunitz_conkunitzin 27..77 CDD:438636
Kunitz-type 93..143 CDD:438633 16/49 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.