DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and CG31609

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:61 Identity:23/61 - (37%)
Similarity:33/61 - (54%) Gaps:0/61 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKY 94
            :.|::..|...:..|.|....|:|.|:...::|..|.|..||||.|.|||||.|::.|..|
  Fly    24 FTIKQPKCWYVANPGPCDDFVKVWGYDYLTNRCIFFYYGGCGGNPNRFYTKEECLKTCRVY 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 20/49 (41%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 20/49 (41%)

Return to query results.
Submit another query.