DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG42827 and Tfpi

DIOPT Version :9

Sequence 1:	NP_651142.3	Gene:	CG42827 / 42763	FlyBaseID:	FBgn0262009	Length:	116	Species:	Drosophila melanogaster
Sequence 2:	XP_008760202.1	Gene:	Tfpi / 29436	RGDID:	61914	Length:	306	Species:	Rattus norvegicus

Alignment Length:	73	Identity:	31/73 - (42%)
Similarity:	39/73 - (53%)	Gaps:	3/73 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    41 CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGLR 105
            ||:.::.|.||...|.::|||...||:.|.|:.||||.|.|.||:.|...|.|...||..|   |
  Rat   226 CLEPADSGLCKASEKRFYYNPAIGKCRQFNYTGCGGNNNNFTTKQDCNRACKKDSSKKSSK---R 287

  Fly   106 RSADYRRK 113
            .....|||
  Rat   288 AKTQRRRK 295

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG42827	NP_651142.3	KU	40..92	CDD:238057	22/50 (44%)
Tfpi	XP_008760202.1	KU	51..104	CDD:238057
		KU	122..174	CDD:238057
		Kunitz_BPTI	225..276	CDD:278443	22/49 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	58	1.000	Domainoid score	I10530
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10083
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	5	4.910