powered by:
Protein Alignment CG42827 and Spint2
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001076018.1 |
Gene: | Spint2 / 292770 |
RGDID: | 735123 |
Length: | 250 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 26/69 - (37%) |
Similarity: | 35/69 - (50%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGLR 105
|..|...|||:.....|:||.....||.|:|..|.||||.:.:||.|::.|.......: .||.
Rat 38 CGVSKVVGKCRASIPRWWYNVTDGTCQPFVYGGCEGNGNNYPSKEECLDKCAGITENTI--DGLA 100
Fly 106 RSAD 109
||:|
Rat 101 RSSD 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.