DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and Tfpi

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_035706.1 Gene:Tfpi / 21788 MGIID:1095418 Length:306 Species:Mus musculus


Alignment Length:82 Identity:28/82 - (34%)
Similarity:37/82 - (45%) Gaps:21/82 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGL- 104
            |||.::.|.||...:.::||....||..|.|:.||||.|.|.|:..|:..|         |||| 
Mouse   225 CLQPADSGLCKASERRFYYNSATGKCHRFNYTGCGGNNNNFTTRRRCLRSC---------KTGLI 280

  Fly   105 -----------RRSADY 110
                       ||.|.:
Mouse   281 KNKSKGVVKIQRRKAPF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 20/49 (41%)
TfpiNP_035706.1 Kunitz_TFPI1_1-like 47..101 CDD:438656
Kunitz_TFPI1_2-like 117..172 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 223..275 CDD:438658 20/49 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.