DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and Col28a1

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:66 Identity:20/66 - (30%)
Similarity:36/66 - (54%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCG 92
            |.|:..|  :...|.::.:.|:|......|:|:.:.:.|..|.:|.|.|:||.|::::.|.|.|.
Mouse  1077 QSEKSLY--KDPRCEEALKPGECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETCI 1139

  Fly    93 K 93
            |
Mouse  1140 K 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 15/49 (31%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.