DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and Spint1

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_058603.2 Gene:Spint1 / 20732 MGIID:1338033 Length:507 Species:Mus musculus


Alignment Length:95 Identity:32/95 - (33%)
Similarity:42/95 - (44%) Gaps:9/95 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DMDSDSLQEQYER---EQYNIR----KKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGG 76
            |...::..|:|..   |..||.    |..|.:..:.|.||.....|:|||...:|..|.|..|.|
Mouse   340 DGSDEATCEKYTSGFDELQNIHFLSDKGYCAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYG 404

  Fly    77 NGNLFYTKESCVEFCGKYDWKKVRKTGLRR 106
            |.|.|..::.|:|.|.....|.|  .||||
Mouse   405 NKNNFEEEQQCLESCRGISKKDV--FGLRR 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 18/51 (35%)
Spint1NP_058603.2 MANEC 42..133 CDD:369396
Kunitz_BPTI 243..294 CDD:333766
LDLa 313..344 CDD:197566 1/3 (33%)
Kunitz_BPTI 368..419 CDD:333766 18/50 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.