DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:97 Identity:30/97 - (30%)
Similarity:48/97 - (49%) Gaps:18/97 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGK--CK-GRRKLWFYNPKKS 64
            :.:|..| |||::...::.| :||.:            |....:.||  || |::::.::..:||
 Worm     1 MNLLLTF-LATILCVSELVS-TLQPE------------CKLPLDMGKTPCKNGKKEIRYHFDQKS 51

  Fly    65 KCQV-FIYSNCGGNGNLFYTKESCVEFCGKYD 95
            ...: |.||.||||.|.|.|:..|...|..||
 Worm    52 NIPLAFEYSGCGGNKNNFKTESECRFTCTGYD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 19/53 (36%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 19/53 (36%)

Return to query results.
Submit another query.