DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and W05B2.2

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:61 Identity:22/61 - (36%)
Similarity:31/61 - (50%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RKKICLQSSEYGKCKGRRKL--WFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYD 95
            |:..|.|..:.|...|...|  |:|:|..::|..|.|..|.||.|.|.|:..|:|.|.:.|
 Worm   504 RELTCNQGLQVGTTCGLSTLQRWYYDPLHNRCNQFEYQGCNGNDNNFVTRVDCIETCHRSD 564

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 19/51 (37%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636 19/51 (37%)
KU 613..665 CDD:197529
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.