| Sequence 1: | NP_651142.3 | Gene: | CG42827 / 42763 | FlyBaseID: | FBgn0262009 | Length: | 116 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_495742.1 | Gene: | K01C8.2 / 186839 | WormBaseID: | WBGene00010457 | Length: | 389 | Species: | Caenorhabditis elegans |
| Alignment Length: | 52 | Identity: | 11/52 - (21%) |
|---|---|---|---|
| Similarity: | 14/52 - (26%) | Gaps: | 10/52 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG42827 | NP_651142.3 | Kunitz-type | 41..91 | CDD:438633 | 9/49 (18%) |
| K01C8.2 | NP_495742.1 | Lustrin_cystein | 137..174 | CDD:464222 | |
| Lustrin_cystein | 235..280 | CDD:464222 | |||
| Lustrin_cystein | 292..337 | CDD:464222 | |||
| Lustrin_cystein | 345..387 | CDD:464222 | 10/51 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||