powered by:
Protein Alignment CG42827 and K01C8.2
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495742.1 |
Gene: | K01C8.2 / 186839 |
WormBaseID: | WBGene00010457 |
Length: | 389 |
Species: | Caenorhabditis elegans |
Alignment Length: | 52 |
Identity: | 11/52 - (21%) |
Similarity: | 14/52 - (26%) |
Gaps: | 10/52 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
||:.. |....|.....|....||.|..|.:...:....|..|
Worm 344 ICING----------KTLLVNGAPKLCTPTTYSQCPYNYSCQQSVNPTVTVC 385
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42827 | NP_651142.3 |
KU |
40..92 |
CDD:238057 |
11/52 (21%) |
K01C8.2 | NP_495742.1 |
Lustrin_cystein |
138..174 |
CDD:291299 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.