DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and K01C8.2

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_495742.1 Gene:K01C8.2 / 186839 WormBaseID:WBGene00010457 Length:389 Species:Caenorhabditis elegans


Alignment Length:52 Identity:11/52 - (21%)
Similarity:14/52 - (26%) Gaps:10/52 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            ||:..          |....|.....|....||.|..|.:...:....|..|
 Worm   344 ICING----------KTLLVNGAPKLCTPTTYSQCPYNYSCQQSVNPTVTVC 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 9/49 (18%)
K01C8.2NP_495742.1 Lustrin_cystein 137..174 CDD:464222
Lustrin_cystein 235..280 CDD:464222
Lustrin_cystein 292..337 CDD:464222
Lustrin_cystein 345..387 CDD:464222 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.