DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and C54D10.10

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:116 Identity:23/116 - (19%)
Similarity:46/116 - (39%) Gaps:30/116 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYG-KCKGR--RKLWFYNPKKS 64
            ::|..:.|..:.:.||:                     |.|..:.| .|..:  ...::::.:.:
 Worm     4 ISIFLLLCCISSVSAIN---------------------CRQEKDTGVNCDNKPITLKFYFDMRTN 47

  Fly    65 KCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGLRRSADYRRKDG 115
            .||...|..||||.|.|.::::|.:.|..:      |.|..:..:.:..||
 Worm    48 VCQPLFYRGCGGNENRFESRDACSDACVPH------KPGKTKKPEKKEDDG 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 14/52 (27%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 14/53 (26%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.