DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and C10G8.2

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_504418.1 Gene:C10G8.2 / 182501 WormBaseID:WBGene00015681 Length:208 Species:Caenorhabditis elegans


Alignment Length:94 Identity:23/94 - (24%)
Similarity:36/94 - (38%) Gaps:26/94 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YNIRKKICLQSSEYGKCK---------GRRKLWFYNPKKSKCQVFIYSNCGGN---GNLFYTKES 86
            |..||.||.||.:..:.:         ||||:.:  ..||..::.|...|..|   .|....::.
 Worm   115 YCTRKGICCQSKDLEELRSEFNVTCPDGRRKVEY--TYKSTTRLLIGKTCSSNICPLNAMCHQKK 177

  Fly    87 CVEFCGK------------YDWKKVRKTG 103
            ...||.|            |:::|:...|
 Worm   178 YFSFCCKKKYNLLIKDILYYEYQKILSLG 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 13/61 (21%)
C10G8.2NP_504418.1 Kunitz_BPTI <38..78 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.