DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and C34F6.1

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_509868.1 Gene:C34F6.1 / 181306 WormBaseID:WBGene00007938 Length:1043 Species:Caenorhabditis elegans


Alignment Length:60 Identity:20/60 - (33%)
Similarity:33/60 - (55%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RKKI--CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKY 94
            ::||  |.|:.|.|........||::.|:::|..|.|....||.|.|.::.:|:|.|.:|
 Worm   874 KRKIDPCDQAVEEGTGSEDLPRWFFDRKQNRCAPFTYGGVAGNENNFISQNTCMEACPEY 933

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 17/53 (32%)
C34F6.1NP_509868.1 Lustrin_cystein 186..231 CDD:291299
Kunitz_BPTI 238..289 CDD:278443
Lustrin_cystein 301..343 CDD:291299
Kunitz_BPTI 351..403 CDD:278443
Kunitz_BPTI 456..512 CDD:278443
KU 564..617 CDD:238057
Lustrin_cystein 623..663 CDD:291299
KU 667..720 CDD:238057
Lustrin_cystein 726..767 CDD:291299
Kunitz_BPTI 772..824 CDD:278443
Lustrin_cystein 829..873 CDD:291299
KU 878..931 CDD:238057 16/52 (31%)
Lustrin_cystein 937..977 CDD:291299
Kunitz_BPTI 982..1033 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.