DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and C34F6.1

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_509868.1 Gene:C34F6.1 / 181306 WormBaseID:WBGene00007938 Length:1043 Species:Caenorhabditis elegans


Alignment Length:60 Identity:20/60 - (33%)
Similarity:33/60 - (55%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RKKI--CLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKY 94
            ::||  |.|:.|.|........||::.|:::|..|.|....||.|.|.::.:|:|.|.:|
 Worm   874 KRKIDPCDQAVEEGTGSEDLPRWFFDRKQNRCAPFTYGGVAGNENNFISQNTCMEACPEY 933

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 16/49 (33%)
C34F6.1NP_509868.1 Lustrin_cystein 185..231 CDD:464222
Kunitz_conkunitzin 239..289 CDD:438636
Lustrin_cystein 304..343 CDD:464222
Kunitz_conkunitzin 352..402 CDD:438636
Kunitz_conkunitzin 457..511 CDD:438636
Kunitz_conkunitzin 566..616 CDD:438636
Lustrin_cystein 622..663 CDD:464222
Kunitz_conkunitzin 669..719 CDD:438636
Lustrin_cystein 725..767 CDD:464222
Kunitz_conkunitzin 773..823 CDD:438636
Lustrin_cystein 828..873 CDD:464222
Kunitz_conkunitzin 880..930 CDD:438636 16/49 (33%)
Kunitz_BPTI 982..1033 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.