DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and tag-290

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_505945.1 Gene:tag-290 / 179593 WormBaseID:WBGene00009386 Length:219 Species:Caenorhabditis elegans


Alignment Length:54 Identity:19/54 - (35%)
Similarity:30/54 - (55%) Gaps:3/54 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 CLQSSEYGK-CKGRR--KLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFC 91
            |.|..:.|. |.|.:  :.::::.:...||.|:||.||||.|.|.|.:.|.:.|
 Worm    19 CTQPKDSGNVCSGSQAERSFYFDTRMKVCQPFLYSGCGGNENRFSTSKECRDAC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 18/52 (35%)
tag-290NP_505945.1 Kunitz-type 19..72 CDD:438633 18/52 (35%)
KU 156..211 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.