powered by:
Protein Alignment CG42827 and F22E12.1
DIOPT Version :9
Sequence 1: | NP_651142.3 |
Gene: | CG42827 / 42763 |
FlyBaseID: | FBgn0262009 |
Length: | 116 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505684.2 |
Gene: | F22E12.1 / 179460 |
WormBaseID: | WBGene00009058 |
Length: | 763 |
Species: | Caenorhabditis elegans |
Alignment Length: | 74 |
Identity: | 24/74 - (32%) |
Similarity: | 39/74 - (52%) |
Gaps: | 2/74 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 DSLQEQYEREQYNI--RKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKE 85
|||:|...:..|.: .:..|.|..:.|.|....:.||::..|.:|....:|.||||.|::|:..
Worm 67 DSLEECSSQCHYQVPTNRDRCFQPHDPGNCYADIERWFFDENKKQCVCSWWSGCGGNSNIYYSYN 131
Fly 86 SCVEFCGKY 94
.|:..||:|
Worm 132 HCMLICGEY 140
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG42827 | NP_651142.3 |
KU |
40..92 |
CDD:238057 |
16/51 (31%) |
F22E12.1 | NP_505684.2 |
KU |
25..76 |
CDD:238057 |
4/8 (50%) |
KU |
85..138 |
CDD:238057 |
16/52 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.