DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and F22E12.1

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:74 Identity:24/74 - (32%)
Similarity:39/74 - (52%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSLQEQYEREQYNI--RKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKE 85
            |||:|...:..|.:  .:..|.|..:.|.|....:.||::..|.:|....:|.||||.|::|:..
 Worm    67 DSLEECSSQCHYQVPTNRDRCFQPHDPGNCYADIERWFFDENKKQCVCSWWSGCGGNSNIYYSYN 131

  Fly    86 SCVEFCGKY 94
            .|:..||:|
 Worm   132 HCMLICGEY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 16/51 (31%)
F22E12.1NP_505684.2 KU 25..76 CDD:238057 4/8 (50%)
KU 85..138 CDD:238057 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.