DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and F22E12.1

DIOPT Version :10

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:74 Identity:24/74 - (32%)
Similarity:39/74 - (52%) Gaps:2/74 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSLQEQYEREQYNI--RKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKE 85
            |||:|...:..|.:  .:..|.|..:.|.|....:.||::..|.:|....:|.||||.|::|:..
 Worm    67 DSLEECSSQCHYQVPTNRDRCFQPHDPGNCYADIERWFFDENKKQCVCSWWSGCGGNSNIYYSYN 131

  Fly    86 SCVEFCGKY 94
            .|:..||:|
 Worm   132 HCMLICGEY 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 16/49 (33%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 4/8 (50%)
KU 85..137 CDD:197529 16/51 (31%)

Return to query results.
Submit another query.