DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and SPINT3

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:81 Identity:24/81 - (29%)
Similarity:42/81 - (51%) Gaps:4/81 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQVFIYSNCG 75
            |..:.|.:::.|:..::..:    ::...:|....|.|.|:.....||:|.:..:|::|.|..||
Human    10 LLILTLCLELRSELARDTIK----DLLPNVCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCG 70

  Fly    76 GNGNLFYTKESCVEFC 91
            ||.|.|..||.|.:||
Human    71 GNSNNFLRKEKCEKFC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 21/52 (40%)
SPINT3NP_006643.1 KU 34..87 CDD:238057 21/53 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6653
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.