DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and LOC100485348

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_031750923.1 Gene:LOC100485348 / 100485348 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:103 Identity:37/103 - (35%)
Similarity:47/103 - (45%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SDSLQEQYEREQYN--IRKKICLQ--SSEY-----------------GKCKGRRKLWFYNPKKSK 65
            |.|||:| :|...|  |.:|.||.  ||:|                 |.|......|:||.::..
 Frog    51 SPSLQKQ-QRSSRNSFITEKQCLMTCSSDYENIYPPGDAVCDLPMESGPCLALIPQWYYNKERGA 114

  Fly    66 CQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTG 103
            |..|:||.|.||||.|..||:|...|  .:.||.|..|
 Frog   115 CHSFLYSGCQGNGNRFENKENCTTLC--LNPKKGRTGG 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 23/70 (33%)
LOC100485348XP_031750923.1 KU 23..75 CDD:412162 11/24 (46%)
KU 88..141 CDD:238057 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.