DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42827 and aplp2

DIOPT Version :9

Sequence 1:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster
Sequence 2:XP_017951425.2 Gene:aplp2 / 100380132 XenbaseID:XB-GENE-5894468 Length:753 Species:Xenopus tropicalis


Alignment Length:91 Identity:25/91 - (27%)
Similarity:38/91 - (41%) Gaps:20/91 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DSDSLQEQYEREQYNIR--------------------KKICLQSSEYGKCKGRRKLWFYNPKKSK 65
            |.|...:.|:.|.||..                    |.:|.|.:..|.|:.....|:::..:.|
 Frog   254 DRDYYYDNYKDEDYNNENPTEPPNERQPSGKDIITDVKSVCSQEAMTGPCRAMMPRWYFDLGQKK 318

  Fly    66 CQVFIYSNCGGNGNLFYTKESCVEFC 91
            |..|||..||||.|.|.:::.|:..|
 Frog   319 CVRFIYGGCGGNRNNFESEDYCMAVC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42827NP_651142.3 KU 40..92 CDD:238057 18/52 (35%)
aplp2XP_017951425.2 A4_EXTRA 31..195 CDD:128326
Kunitz_BPTI 293..345 CDD:394972 18/52 (35%)
APP_E2 349..531 CDD:403970
JMTM_Notch_APP 670..750 CDD:425406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.