DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and AGBL4

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:352 Identity:68/352 - (19%)
Similarity:115/352 - (32%) Gaps:123/352 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 RQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQALIDA---------------------- 159
            |.|..:...:::.|...|.::.::.:...:......||..:|:                      
Human   150 RCPDHRKNYVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRK 214

  Fly   160 -NYLEVAPEDTKPEEFDWK------RYHPLESINAWLKKLAETHPEVLLVELGVSAQGRP---IL 214
             :.|.:...|...|..:.|      |.||.|:.::::                  .||.|   ..
Human   215 LDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFV------------------CQGIPPGHWA 261

  Fly   215 GVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDG 279
            .:..:|.|        ..|||   |::|.    |||.||:....|. .|.....:.|.|.:||||
Human   262 ALSSSFQN--------SPGIH---WMSPG----IIDFLVSQHPIAC-VLREYLVFKIAPMLNPDG 310

  Fly   280 -YQYTFKGDRMWRKNRALFGICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEV------E 337
             |...::...|            |.||||    ||.      ||..:.:.......::      :
Human   311 VYLGNYRCSLM------------GFDLNR----HWL------DPSPWVHPTLHGVKQLIVQMYND 353

  Fly   338 TQRMIEFIRHRVESERIRTFISLHSYSQMIM-FPYGHSAERVDNYHDLTDIGKLAANKIKDVS-- 399
            .:..:||            :|.:|::|.|:. |.||:..|..:.:.......||.....:|.|  
Human   354 PKTSLEF------------YIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYS 406

  Fly   400 -------------GRIYKSGSIYETIY 413
                         ||.:..|.:..|.|
Human   407 STSFNRDAVKAGTGRRFLGGLLDHTSY 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 6/41 (15%)
M14_CP_A-B_like 179..472 CDD:199844 56/261 (21%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 62/312 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.