DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and AGBL2

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:229 Identity:49/229 - (21%)
Similarity:80/229 - (34%) Gaps:78/229 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RTTVFVESGIHARE----WIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQYTFK 285
            :..|.:.:.:|..|    |:......:|   |.||.|:  |.|.....:.:.|.:||||      
Human   452 KKAVVLSARVHPGESNGSWVMKGFLDFI---LSNSPDA--QLLRDIFVFKVLPMLNPDG------ 505

  Fly   286 GDRMWRKNRALFGICR----GVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIR 346
                     .:.|..|    |.||||    |:........||.:           .|:.|   |:
Human   506 ---------VIVGNYRCSLAGRDLNR----HYKTILKESFPCIW-----------YTRNM---IK 543

  Fly   347 HRVESERIRTFISLHSYSQM-IMFPYG----------HSAERV------------DNYHDLTDIG 388
            ..:|...:..:...|.:|:. .:|.||          |  |||            .::|..    
Human   544 RLLEEREVLLYCDFHGHSRKNNIFLYGCNNNNRKYWLH--ERVFPLMLCKNAPDKFSFHSC---- 602

  Fly   389 KLAANKIKDVSGRI--YKSGSIYE-TIYPSSGGS 419
            .....|.|:.:||:  ::.|.:.. |:..:.|||
Human   603 NFKVQKCKEGTGRVVMWRMGILNSYTMESTFGGS 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 49/229 (21%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 49/229 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.