DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001364026.1 Gene:Agtpbp1 / 67269 MGIID:2159437 Length:1218 Species:Mus musculus


Alignment Length:330 Identity:67/330 - (20%)
Similarity:106/330 - (32%) Gaps:104/330 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LEQASDSCSFMGHARQP-----GQK------LTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQAL 156
            :...:|.|.:..|..:.     |||      :|..|......|.....:.|..|:..|..:.|.|
Mouse   790 IRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVNFPHKDDVCYFAYHYPYTYSTLQMHLQKL 854

  Fly   157 IDANYLEVAPEDTKPEEFDWKR----------YHPLESINAWLKKLAETHPEVLLVELGVSAQGR 211
            ..|:         .|::..:::          ..||.:|.|.        ||....|.....:.|
Mouse   855 ESAH---------NPQQIYFRKDVLCETLSGNICPLVTITAM--------PESNYYEHICQFRTR 902

  Fly   212 PILGVQIAFDNENRTTVFVESGIHARE----WIAPATATYIIDQLVNSKDSAVQALARSQRWYIF 272
            |.              :|:.:.:|..|    |:...|..|::     |.....|:|..|..:.|.
Mouse   903 PY--------------IFLSARVHPGETNASWVMKGTLEYLM-----SNSPTAQSLRESYIFKIV 948

  Fly   273 PTVNPDGYQYTFKGDRMWRKNRALFGIC--RGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASE 335
            |.:||||   ...|:..          |  .|.||||    .|........|..|...|      
Mouse   949 PMLNPDG---VINGNHR----------CSLSGEDLNR----QWQSPNPELHPTIYHAKG------ 990

  Fly   336 VETQRMIEFIRHRVESERI-RTFISLHSYS-QMIMFPYGHS-AERVDNYHD-------LTDIGKL 390
                    .:::....:|: ..:...|.:| :..:|.||.| .|.|.:.||       :.|:|..
Mouse   991 --------LLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDNSASCDIVEDMGYR 1047

  Fly   391 AANKI 395
            ...||
Mouse  1048 TLPKI 1052

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 14/66 (21%)
M14_CP_A-B_like 179..472 CDD:199844 51/233 (22%)
Agtpbp1NP_001364026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..617
Pepdidase_M14_N 704..838 CDD:407865 9/47 (19%)
M14_Nna1 861..1131 CDD:349477 51/250 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1193..1218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.