DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Cpa3

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_062173.1 Gene:Cpa3 / 54242 RGDID:2390 Length:417 Species:Rattus norvegicus


Alignment Length:406 Identity:124/406 - (30%)
Similarity:205/406 - (50%) Gaps:30/406 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RYDHTRIYQVELASEEHVRLFQALEQA-------SDSCSFMGHARQPGQKLTIMVTGAKVADFDD 137
            ::|..::::|:|..|:...:.:.|.|.       .|:.    |.......:...||..:......
  Rat    20 QFDREKVFRVKLQDEKQASILKNLTQTIELDFWYPDAI----HDIAVNMTVDFRVTEKESQTIQS 80

  Fly   138 LVHSYNVTHRVLNYNFQALIDANYLEVAPEDTKPE---EFDWKRYHPLESINAWLKKLAETHPE- 198
            .:..:.:.:.:|..:.|..||..:      |.|.|   ...:.:|:....|.:|.:|:.|.||| 
  Rat    81 TLEQHKMDYEILINDLQEEIDKQF------DVKEEIAGRHSYAKYNDWNKIVSWTEKMVEKHPEM 139

  Fly   199 VLLVELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNS--KDSAVQ 261
            |..:::|.:.:..|:..::|...:..|..:|::.|||||||::||...:.:.|...|  |:..:.
  Rat   140 VSRIKIGSTVEDNPLYVLKIGRKDGERKAIFMDCGIHAREWVSPAFCQWFVYQAAKSYGKNKIMT 204

  Fly   262 ALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRAL--FGICRGVDLNRNFPFHWNVTGASGDPCR 324
            .|.....:|:.|..|.|||.:::..||||||||:.  ...|.|.||||||...|:.:..:.:||.
  Rat   205 KLLDRMNFYVLPVFNVDGYIWSWTKDRMWRKNRSKNPNSTCIGTDLNRNFDVSWDSSPNTDNPCL 269

  Fly   325 YDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGK 389
            ..|.||:..||.||:.:..|||..:.|  |:.:|:.||||||::||||::.:...|:.||..:.:
  Rat   270 SVYRGPAPESEKETKAVTNFIRSHLNS--IKAYITFHSYSQMLLFPYGYTIKLPPNHQDLLKVAR 332

  Fly   390 LAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEI 454
            :|.:.:.......|..|.|..|||.:||.|.|||: .|.|..||::|||....|.  |:|....|
  Rat   333 IATDVLSSRYETRYIYGPIASTIYKTSGSSLDWAY-DLGIKHTFAFELRDKGKSG--FLLPESRI 394

  Fly   455 EPTAAEAFASIQTIVQ 470
            :||..|...|::.|.:
  Rat   395 KPTCKETMLSVKFIAK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 12/77 (16%)
M14_CP_A-B_like 179..472 CDD:199844 107/297 (36%)
Cpa3NP_062173.1 Propep_M14 28..102 CDD:280416 12/77 (16%)
Peptidase_M14_like 114..413 CDD:299699 107/302 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.