DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and cpb1

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:451 Identity:134/451 - (29%)
Similarity:215/451 - (47%) Gaps:66/451 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WLLLLLVSSVCVIQESKASSFCTKADQCALDEEIKTAADSVQARYDH-TRIYQVELASEEHVRLF 100
            |.||||||                           .||.|.:.|..| .::::|...:.|||.|.
 Frog     2 WALLLLVS---------------------------LAAVSAEPRNFHGEKVFRVIPQNAEHVELI 39

  Fly   101 QALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQALID------- 158
            :::.|......::..:.|       :|...|.|||....|        ::|..|||:.       
 Frog    40 KSMAQTEGLDFWLPDSAQ-------LVEQGKRADFHADGH--------VSYEVQALLQQSGMPYE 89

  Fly   159 --ANYLEVAPEDTKPEEF----DWKRYHPLESINAWLKKLAETHPE-VLLVELGVSAQGRPILGV 216
              .|.|:.|.|..:....    .:::|:.|::||||...:|..:|. |....:|.|.|||||..:
 Frog    90 ILINDLQDALEKQRDSNIRAVHSYEKYNDLDTINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLL 154

  Fly   217 QIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNS--KDSAVQALARSQRWYIFPTVNPDG 279
            ::.....|:..||::.|.||||||:||...:.:.:.|::  .:|...:|..:...|:.|.:|.||
 Frog   155 KVGKSGANKKAVFIDCGFHAREWISPAFCQWFVKEAVSAYGVESEFTSLLDNLDIYVLPVLNVDG 219

  Fly   280 YQYTFKGDRMWRKNRAL--FGICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMI 342
            |.||:..:|||||.|:.  ...|.|.|.||||...|...|||...|...|.|.:..||.||:.:.
 Frog   220 YVYTWTTNRMWRKTRSANPNSTCIGTDPNRNFNAGWCTAGASTRACDETYCGSAPESEPETKALA 284

  Fly   343 EFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGS 407
            .|||..:.:  |:.::::||||||::|||.:|.....::::|..:.:.|.|.:..:....|..|.
 Frog   285 NFIRANIPA--IKGYLTIHSYSQMLLFPYSYSYAVAKDHNELNAVAQGAVNSLTSLYKTKYTYGP 347

  Fly   408 IYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFILSAKEIEPTAAEAFASIQTI 468
            ...|||.::|||.|||: ...:..::::|||......  |.|...:|:||..|...:::.|
 Frog   348 GGSTIYLAAGGSDDWAY-DAGVKFSYTFELRDTGRYG--FALPESQIKPTCEETMLAVKYI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 17/79 (22%)
M14_CP_A-B_like 179..472 CDD:199844 101/295 (34%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 20/85 (24%)
M14_CPB 111..410 CDD:349443 101/300 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.