Sequence 1: | NP_651141.2 | Gene: | CG4408 / 42762 | FlyBaseID: | FBgn0039073 | Length: | 479 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017210489.1 | Gene: | agbl5 / 445479 | ZFINID: | ZDB-GENE-040822-29 | Length: | 886 | Species: | Danio rerio |
Alignment Length: | 310 | Identity: | 57/310 - (18%) |
---|---|---|---|
Similarity: | 101/310 - (32%) | Gaps: | 136/310 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 229 FVESGIHAREWIAPATATY--IIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWR 291
Fly 292 KNRALFGICRGVDLNRNF-----PFHWNVTG----------------ASGDPCR---YDYSGPSA 332
Fly 333 ASEVETQRMIEFI---------------------------------RHRVESERIRT-------- 356
Fly 357 -------------FISLHSY-SQMIMFPYGHS----AERVDN--YHDLTDIG-----KLAAN--- 393
Fly 394 -----------KIKDVSGRI-----------------YKSGSIYETIYPS 415 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4408 | NP_651141.2 | Propep_M14 | 88..159 | CDD:280416 | |
M14_CP_A-B_like | 179..472 | CDD:199844 | 57/310 (18%) | ||
agbl5 | XP_017210489.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2866 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |