DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and CG8539

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001261520.1 Gene:CG8539 / 38842 FlyBaseID:FBgn0035791 Length:385 Species:Drosophila melanogaster


Alignment Length:299 Identity:89/299 - (29%)
Similarity:145/299 - (48%) Gaps:40/299 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 LKKLAETHP-EVLLVELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQL 252
            ||.:|.|:. ..|.:.:..:..|||           .:..:|:::.:|:|||:.||.|...|.:|
  Fly    61 LKDVARTYENRALKMAIITNGDGRP-----------GKRVIFLDAALHSREWMTPAAALLTIHKL 114

  Fly   253 V-----NSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRA-LFGICRGVDLNRNFPF 311
            |     ||.      |.....|:|.|..|||||:|:...:|.||..|. ..|.|.|.:|||||..
  Fly   115 VVEFAENSD------LLTDYDWHIMPLANPDGYEYSRNTERYWRNTRTPNGGNCFGTNLNRNFAV 173

  Fly   312 HWNVTGASG-----DPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPY 371
            .|||    |     |||..:|:|.|..||||.:.:.:.:...|||:|...::|||:.::.:.:|:
  Fly   174 DWNV----GFPELKDPCDENYAGSSPFSEVEARTVRDIMHGLVESKRAVMYLSLHTANRSVFYPW 234

  Fly   372 GHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWA--HGQLKIPITFS 434
            .:..:.|.|..:..:||:..|::|...:|...|:....:......|.|.|:|  .|   .|::|.
  Fly   235 VYDTDPVSNQKEHDEIGRFVADRILQSTGTFIKTWQYAKYAGTFGGTSMDYALLAG---FPLSFV 296

  Fly   435 YELRGPADS--EDLFILSAKEIEPTAAEAFASIQTIVQE 471
            :|:.|....  |..|...|::|...|.|::..|:...::
  Fly   297 FEMSGTGRDHVEYKFFPPARDIRHLAEESWTGIKAFAEK 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 89/299 (30%)
CG8539NP_001261520.1 M14_CP_A-B_like 38..335 CDD:199844 89/297 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.