DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and CG8564

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:363 Identity:109/363 - (30%)
Similarity:164/363 - (45%) Gaps:63/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 DLVHSYNVTHRVLNYNFQALID--ANYLEV-------APEDTKPEEFDWKRYHPLESINAWLKKL 192
            |::|:| :.::.:|...|.|..  |:::.|       ...:.:..|.:|     :.|.|..|...
  Fly    49 DILHTY-LDYKQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINW-----MNSENVELSPQ 107

  Fly   193 AETHPEVLLVELGVSAQGR---PILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVN 254
            ...|...|   ..:...||   |::.|    ....|.|||:|:|.||||||:.:||...|.||..
  Fly   108 MREHSPRL---FDIGPNGRFTVPVIHV----GEHCRKTVFIEAGTHAREWISVSTALNCIYQLTE 165

  Fly   255 SKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFGICR--GVDLNRNFPFHWNVTG 317
            .....::.| |..|:.|.|.||||||:|:...:..|||||......:  |.|.|||:...||   
  Fly   166 RYTRNIEVL-RKLRFIIVPLVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWN--- 226

  Fly   318 ASGDPC---RYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVD 379
             || |.   |..|.|.|..||.|| |.:..|..|: |..:..|:|||||.|.||:|:|:..:...
  Fly   227 -SG-PSKINRNTYKGESPFSEPET-RAMRCILDRM-SSNLLFFLSLHSYGQSIMYPWGYCRDNPI 287

  Fly   380 NYHDLTDIGKLAANKIKDVSGRIYKSGSI----YETIYPSSGGSKDWAHGQLKIPITFSYELRGP 440
            .:.:|:.:.....:.||..:||.|::|||    ..||   :|...|:.:|.||:|:....||   
  Fly   288 YWRELSSLANSGKSAIKSYNGREYRTGSISCLTKRTI---AGSVVDYVYGVLKVPMALVMEL--- 346

  Fly   441 ADSEDLFILSAKEIEPTAAEAFASIQTIVQEAGKRGYY 478
                           |:....|.....::.:.|...:|
  Fly   347 ---------------PSRELGFQPPVEMISQIGHESWY 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 6/23 (26%)
M14_CP_A-B_like 179..472 CDD:199844 97/304 (32%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 107/358 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.