DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Agbl5

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_038968402.1 Gene:Agbl5 / 362710 RGDID:1598311 Length:901 Species:Rattus norvegicus


Alignment Length:100 Identity:26/100 - (26%)
Similarity:44/100 - (44%) Gaps:15/100 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 PILGVQIAFDNENRTTVFVESGIHAREWIAPATATY--IIDQLVNSKDSAVQALARSQRWYIFPT 274
            |.:|....|....:...|:.|.:|..|  .|::..:  .:|.::...|...|.|.|...:.:.|.
  Rat   229 PDVGTPRPFRFTGKRIFFLSSRVHPGE--TPSSFVFNGFLDFILRPDDPRAQTLRRLFVFKLIPM 291

  Fly   275 VNPDGYQYTFKGDRMWRKNRALFGICRGVDLNRNF 309
            :||||   ..:|.  :|.:      .|||:|||.:
  Rat   292 LNPDG---VVRGH--YRTD------SRGVNLNRQY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 26/99 (26%)
Agbl5XP_038968402.1 Pepdidase_M14_N 10..155 CDD:407865
M14_AGBL5_like 183..575 CDD:349455 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.