DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and CG32379

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_729252.2 Gene:CG32379 / 326211 FlyBaseID:FBgn0052379 Length:344 Species:Drosophila melanogaster


Alignment Length:351 Identity:107/351 - (30%)
Similarity:169/351 - (48%) Gaps:28/351 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VADFDDLVHSYNVTHRVLNYNFQALIDANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETH 196
            :.|...|||:    .|..|...:.||...:::|.           ..::....||.:|..|.|..
  Fly    12 IEDLAPLVHA----QRAENLRKKLLIQWPHIDVL-----------SAFYTHSEINDYLDSLLERF 61

  Fly   197 PE-VLLVELGVSAQGRP--ILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLV-NSKD 257
            |: |.:.:.|.|.:.||  :|.:.......|:..:.::..:||||||:|:.|.|||.||: |..|
  Fly    62 PKRVQVKQFGWSYERRPLKVLTITNGDGRRNKPVILIDGTVHAREWISPSMALYIIQQLLDNYGD 126

  Fly   258 SAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFG--ICRGVDLNRNFPFHW-NVTGAS 319
            :  |.|.:...|.|.|.||.|||:||....|.|||:|....  .|.|.|:||||.:.| :..|:|
  Fly   127 N--QELLQDYDWVIMPVVNADGYEYTHTDSRYWRKSRRPTSNPECIGTDINRNFGYEWGHDEGSS 189

  Fly   320 GDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDL 384
            .|||...|.|.....:.|:|.:.:.:.|  ...|:..::|||||....:.|:|::::..|.|.|:
  Fly   190 SDPCENIYRGERPFDQSESQVLRDVMLH--YKGRLNFYLSLHSYGNYFLLPWGYTSDFPDTYQDM 252

  Fly   385 TDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLFIL 449
            ..:....|..|...:..||..||.|..:||:||.:.|:|.|.:...:..:.||  ||.....|..
  Fly   253 MSVADAGAKAIIYSTNGIYSYGSTYYVLYPTSGDTTDFAFGVVNATVAMTMEL--PAAGFQGFDP 315

  Fly   450 SAKEIEPTAAEAFASIQTIVQEAGKR 475
            ...:||....|::..::.:..|..:|
  Fly   316 WISQIERLVTESWVGVRAMAAEVIRR 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 8/26 (31%)
M14_CP_A-B_like 179..472 CDD:199844 96/299 (32%)
CG32379NP_729252.2 M14_CP_A-B_like 44..338 CDD:199844 96/299 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466979
Domainoid 1 1.000 158 1.000 Domainoid score I1007
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 1 1.000 - - otm46992
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.