DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Cpa6

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_038965675.1 Gene:Cpa6 / 312913 RGDID:1311764 Length:290 Species:Rattus norvegicus


Alignment Length:289 Identity:101/289 - (34%)
Similarity:158/289 - (54%) Gaps:23/289 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LAETHPEVLLV-ELGVSAQGRPILGVQIAFDNE-NRTTVFVESGIHAREWIAPATATYIIDQ--L 252
            |.:|.|.::.| .:|.|.:||.:|.:|:...:: .:..|:::.||||||||.||...:.:.:  |
  Rat     4 LNQTQPGLVRVFPIGRSFEGRSLLIIQLGRKSQVYKRAVWIDCGIHAREWIGPAFCQWFVKEAIL 68

  Fly   253 VNSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFG--ICRGVDLNRNFPFHWNV 315
            ....|.|::.:.....:||.|.:|.|||.:::..||.|||.|:...  .|||||.|||:...|..
  Rat    69 TYKTDPAMRKMLNHLYFYIMPVLNVDGYHFSWTHDRFWRKTRSRNSKFHCRGVDANRNWKVKWCD 133

  Fly   316 TGASGDPCRYDYSGPSAASEVETQRMIEFIR-HRVESERIRTFISLHSYSQMIMFPYGHSAERVD 379
            .|||.|||...|.||...||.|.:.:..|:| ||   :|||.::|.|:|:||:::||.:....:.
  Rat   134 EGASADPCDDTYCGPFPESEPEVKAVANFLRKHR---KRIRAYLSFHAYAQMLLYPYSYKHATIP 195

  Fly   380 NYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELR-----G 439
            |:..:......|...::.|.|..|:.|...:|:|.|||.|.|||: :..||.:|::|||     |
  Rat   196 NFSCVEFAAHKAVKALRSVHGIRYRHGPASQTLYVSSGNSMDWAY-KNGIPYSFAFELRDTGYFG 259

  Fly   440 PADSEDLFILSAKEIEPTAAEAFASIQTI 468
                   |:|....|:||..|...:::.|
  Rat   260 -------FLLPEMLIKPTCTETMLAVKNI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 101/289 (35%)
Cpa6XP_038965675.1 Peptidase_M14_like 1..289 CDD:416253 101/289 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.750

Return to query results.
Submit another query.