DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001099570.1 Gene:Agtpbp1 / 290986 RGDID:1306307 Length:1219 Species:Rattus norvegicus


Alignment Length:320 Identity:63/320 - (19%)
Similarity:109/320 - (34%) Gaps:84/320 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LEQASDSCSFMGHARQP-----GQK------LTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQAL 156
            :...:|.|.:..|..:.     |||      :|..|......|.....:.|..|:..|..:.|.|
  Rat   791 IRMGTDICYYKNHFSRSSVAAGGQKGKSYYTITFTVVFPHKDDVCYFAYHYPYTYSTLQMHLQKL 855

  Fly   157 IDANYLEVAPEDTKPEEFDWKRYHPLESINAWLKKLAETHPEVLLVELGVSAQGRPILGVQIAFD 221
            ..|:         .|::..:::....|:::      ..:.|.|.:..:..|:....|...:    
  Rat   856 ESAH---------NPQQIYFRKDVLCETLS------GNSCPLVTITAMPESSYYEHICQFR---- 901

  Fly   222 NENRTTVFVESGIHARE----WIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQY 282
              .|..:|:.:.:|..|    |:...|..|::     |.....|:|..:..:.|.|.:||||   
  Rat   902 --TRPYIFLSARVHPGETNASWVMKGTLEYLM-----SNSPTAQSLREAYIFKIVPMLNPDG--- 956

  Fly   283 TFKGDRMWRKNRALFGIC--RGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFI 345
            ...|:..          |  .|.||||    .|........|..|...|              .:
  Rat   957 VINGNHR----------CSLSGEDLNR----QWQSPNPELHPTIYHAKG--------------LL 993

  Fly   346 RHRVESERI-RTFISLHSYS-QMIMFPYGHS-AERVDNYHD-------LTDIGKLAANKI 395
            ::....:|: ..:...|.:| :..:|.||.| .|.|.:.||       :.|:|.....||
  Rat   994 QYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDNAASCDVVEDMGYRTLPKI 1053

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 14/66 (21%)
M14_CP_A-B_like 179..472 CDD:199844 47/233 (20%)
Agtpbp1NP_001099570.1 Pepdidase_M14_N 705..839 CDD:407865 9/47 (19%)
M14_Nna1 862..1132 CDD:349477 47/240 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.