DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and AGTPBP1

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001273644.1 Gene:AGTPBP1 / 23287 HGNCID:17258 Length:1278 Species:Homo sapiens


Alignment Length:324 Identity:62/324 - (19%)
Similarity:106/324 - (32%) Gaps:92/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQALIDANYLEVAPE 167
            :...:|.|.:..|.    .:.::...|.|...:      |.:|..|   ||....|..|      
Human   850 IRMGTDICYYKNHF----SRSSVAAGGQKGKSY------YTITFTV---NFPHKDDVCY------ 895

  Fly   168 DTKPEEFDWKRYHPLESINAWLKKLAETH-PEVLLVELGV-----SAQGRPILGVQIAFDN---- 222
                  |.:...:...::...|:||...| |:.:.....|     |....|::.:....::    
Human   896 ------FAYHYPYTYSTLQMHLQKLESAHNPQQIYFRKDVLCETLSGNSCPLVTITAMPESNYYE 954

  Fly   223 -----ENRTTVFVESGIHARE----WIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPD 278
                 .||..||:.:.:|..|    |:...|..|::     |.:...|:|..|..:.|.|.:|||
Human   955 HICHFRNRPYVFLSARVHPGETNASWVMKGTLEYLM-----SNNPTAQSLRESYIFKIVPMLNPD 1014

  Fly   279 GYQYTFKGDRMWRKNRALFGIC--RGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRM 341
            |   ...|:..          |  .|.||||    .|........|..|...|            
Human  1015 G---VINGNHR----------CSLSGEDLNR----QWQSPSPDLHPTIYHAKG------------ 1050

  Fly   342 IEFIRHRVESERI-RTFISLHSYS-QMIMFPYG--------HSAERVDNYHDLTDIGKLAANKI 395
              .:::....:|: ..:...|.:| :..:|.||        |:.:...:...:.|.|.....||
Human  1051 --LLQYLAAVKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTNDNATSCDVVEDTGYRTLPKI 1112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 10/55 (18%)
M14_CP_A-B_like 179..472 CDD:199844 49/248 (20%)
AGTPBP1NP_001273644.1 M14_Nna1 911..1188 CDD:133116 49/238 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.