DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and ccpp-1

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_491674.2 Gene:ccpp-1 / 172241 WormBaseID:WBGene00018995 Length:1015 Species:Caenorhabditis elegans


Alignment Length:223 Identity:50/223 - (22%)
Similarity:89/223 - (39%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 YHPLESINAWLKKLAETHPEVLLVELGVSAQGRPILGVQI-----AFDNENRTTVFVESGIHARE 238
            |..|.|..:.|||..:.:.......:|.|..|.||..:.|     |.:...|..:.:.:.:|..|
 Worm   731 YSFLNSSLSMLKKRKQENVYCREDVIGHSLAGNPIKMLTITTPASAAEIAAREVIVLSARVHPGE 795

  Fly   239 ----WIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFGI 299
                ||...    |::.|:..:.:.:..|..|..:.|.|.:||||.           .|.:....
 Worm   796 TNASWIMQG----ILENLLCRQSNEMYRLRESFIFKIVPMINPDGV-----------TNGSHRCS 845

  Fly   300 CRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVE---TQRMIEFIRHRVESERIRTFISLH 361
            ..|:||||    .|:              .|:.|...|   |:.:|::: ..|.:::...::.:|
 Worm   846 LAGIDLNR----MWD--------------RPNEALHPEVFATKAIIQYL-CEVANKKPFAYVDIH 891

  Fly   362 SYS-QMIMFPYGHSAERVDNYHDLTDIG 388
            .:| :...|.||::|.......|:.|:|
 Worm   892 GHSKKWDYFVYGNNASESWRADDVLDVG 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 50/223 (22%)
ccpp-1NP_491674.2 M14_Nna1_like_2 738..1011 CDD:199859 47/216 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.