DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and ccpp-1

DIOPT Version :10

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_491674.2 Gene:ccpp-1 / 172241 WormBaseID:WBGene00018995 Length:1015 Species:Caenorhabditis elegans


Alignment Length:223 Identity:50/223 - (22%)
Similarity:89/223 - (39%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 YHPLESINAWLKKLAETHPEVLLVELGVSAQGRPILGVQI-----AFDNENRTTVFVESGIHARE 238
            |..|.|..:.|||..:.:.......:|.|..|.||..:.|     |.:...|..:.:.:.:|..|
 Worm   731 YSFLNSSLSMLKKRKQENVYCREDVIGHSLAGNPIKMLTITTPASAAEIAAREVIVLSARVHPGE 795

  Fly   239 ----WIAPATATYIIDQLVNSKDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRALFGI 299
                ||...    |::.|:..:.:.:..|..|..:.|.|.:||||.           .|.:....
 Worm   796 TNASWIMQG----ILENLLCRQSNEMYRLRESFIFKIVPMINPDGV-----------TNGSHRCS 845

  Fly   300 CRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVE---TQRMIEFIRHRVESERIRTFISLH 361
            ..|:||||    .|:              .|:.|...|   |:.:|::: ..|.:::...::.:|
 Worm   846 LAGIDLNR----MWD--------------RPNEALHPEVFATKAIIQYL-CEVANKKPFAYVDIH 891

  Fly   362 SYS-QMIMFPYGHSAERVDNYHDLTDIG 388
            .:| :...|.||::|.......|:.|:|
 Worm   892 GHSKKWDYFVYGNNASESWRADDVLDVG 919

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 87..159 CDD:460505
M14_CP_A-B_like 179..466 CDD:349433 50/223 (22%)
ccpp-1NP_491674.2 Pepdidase_M14_N 589..725 CDD:407865
Peptidase_M14_like 749..1012 CDD:472171 44/205 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.