DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Y47G6A.19

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001379340.1 Gene:Y47G6A.19 / 171921 WormBaseID:WBGene00021645 Length:509 Species:Caenorhabditis elegans


Alignment Length:422 Identity:138/422 - (32%)
Similarity:213/422 - (50%) Gaps:63/422 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDDLVHSYNVTHRVLNYNFQ-ALIDAN 160
            :|||:..:  :|...|..........:.|||    ..:..|....|...|   .|.|| |:.|.:
 Worm    40 IRLFETAD--TDRADFWHAPSVVNGTVDIMV----APEHTDQFRQYLEKH---GYTFQVAIDDLH 95

  Fly   161 YLEVAPE-----DTKPEEFDWKR---------------YHPLESINAWLKKLAETHPEVL-LVEL 204
            .|.:..|     .:..:.|..||               |:....::.||:::||..|::. |:::
 Worm    96 KLLIEKEGNLSTHSNDDAFFLKRLHDDVGFHSRLRMGEYYSYSVLSTWLERIAENMPDIAKLIKV 160

  Fly   205 GVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNSK--DSAVQALARSQ 267
            |.:.:||.|||::...|..::..|.:::|||||||.|..||:|.|:.:||.:  |..:|....:.
 Worm   161 GTTIEGRDILGLKFGKDTPDKKIVVIDAGIHAREWAAIHTASYFINLIVNGREEDPQIQNYLDNI 225

  Fly   268 RWYIFPTVNPDGYQYTFKGD------RMWRKNR-----ALFGI----CRGVDLNRNFPFHWNVTG 317
            ..||.|.:|||||:|| :.|      |||||:|     |..|:    |.||||||||.|.::..|
 Worm   226 VLYIIPVLNPDGYEYT-RTDKTNPRARMWRKSRSPKACAFDGVRNSCCMGVDLNRNFDFRFSEIG 289

  Fly   318 ASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNY- 381
            ||..||...|.||||.||.|::...:|:...  ..|:..:|:||||||:.::.|.|   |...| 
 Worm   290 ASRYPCSEIYHGPSAFSEPESKAYSQFLTSL--KGRLEAYITLHSYSQLWIYSYSH---RKFTYA 349

  Fly   382 HDLTDIGKLAANKIKDVS---GRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADS 443
            .|:.:..::||..::::.   |..|:.|:..|.||..||||.|||...|||..:::.||| |...
 Worm   350 PDIEETRRVAAKAVQELGRMYGTKYRHGTGPEIIYAFSGGSTDWAKETLKIKYSYTIELR-PGYE 413

  Fly   444 EDL----FILSAKEIEPTAAEAFASIQTIVQE 471
            ..:    |:|...::.|||.|.:|.:..::.|
 Worm   414 GIIEWNGFVLDKNQLIPTAKETWAGVTVVLDE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 15/62 (24%)
M14_CP_A-B_like 179..472 CDD:199844 117/319 (37%)
Y47G6A.19NP_001379340.1 Propep_M14 32..102 CDD:396700 17/70 (24%)
M14_CP_A-B_like 134..446 CDD:349433 117/319 (37%)
ShK 467..504 CDD:396228
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47975
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100142
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.