DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and CPO

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_775100.1 Gene:CPO / 130749 HGNCID:21011 Length:374 Species:Homo sapiens


Alignment Length:319 Identity:109/319 - (34%)
Similarity:187/319 - (58%) Gaps:16/319 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 EVAPEDTKP---EEFDWKRYHPLESINAWLKKLAETHPEVLLVE-LGVSAQGRPILGVQIAFDNE 223
            |:..:...|   |.:.:..|||:..|..|:::::|.:.||:... |||:.:..|:..::|:..:.
Human    31 EIVDKSVSPWSLETYSYNIYHPMGEIYEWMREISEKYKEVVTQHFLGVTYETHPMYYLKISQPSG 95

  Fly   224 N-RTTVFVESGIHAREWIAPATATYIIDQLV-NSKD-SAVQALARSQRWYIFPTVNPDGYQYTFK 285
            | :..::::.|||||||||||...:.:.::: |.|| |:::.|.|:..:|:.|.:|.|||.||:.
Human    96 NPKKIIWMDCGIHAREWIAPAFCQWFVKEILQNHKDNSSIRKLLRNLDFYVLPVLNIDGYIYTWT 160

  Fly   286 GDRMWRKNRALF--GICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIRHR 348
            .||:|||:|:..  |.|.|.||||||...|...|||.:.....:.|....||.||:.:..||..:
Human   161 TDRLWRKSRSPHNNGTCFGTDLNRNFNASWCSIGASRNCQDQTFCGTGPVSEPETKAVASFIESK 225

  Fly   349 VESERIRTFISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIY 413
              .:.|..|:::|||.|:|:.|||::..:..|:.::..:|:.|||.:|...|..|:.||..:.:|
Human   226 --KDDILCFLTMHSYGQLILTPYGYTKNKSSNHPEMIQVGQKAANALKAKYGTNYRVGSSADILY 288

  Fly   414 PSSGGSKDWAHGQLKIPITFSYELRGPADSEDL-FILSAKEIEPTAAEAFASIQTIVQE 471
            .|||.|:|||. .:.||.::::|||   ||... |:|...:|:||..|...::.:::.:
Human   289 ASSGSSRDWAR-DIGIPFSYTFELR---DSGTYGFVLPEAQIQPTCEETMEAVLSVLDD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 106/300 (35%)
CPONP_775100.1 M14_CPO 47..344 CDD:133105 106/303 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157711
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.