DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and Cpa3

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_031779.1 Gene:Cpa3 / 12873 MGIID:88479 Length:417 Species:Mus musculus


Alignment Length:416 Identity:124/416 - (29%)
Similarity:208/416 - (50%) Gaps:30/416 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IKTAADSVQARYDHTRIYQVELASEEHVRLFQALEQA-------SDSCSFMGHARQPGQKLTIMV 127
            |.|........:|..::::|:|.:|:|..:.:.|.|:       .|:.    |.......:...|
Mouse    10 IYTTLAIAPVHFDREKVFRVKLQNEKHASVLKNLTQSIELDFWYPDAI----HDIAVNMTVDFRV 70

  Fly   128 TGAKVADFDDLVHSYNVTHRVLNYNFQALIDANYLEVAPEDTKPE---EFDWKRYHPLESINAWL 189
            :..:.......:..:.:.:.:|.::.|..|:..:      |.|.|   ...:.:|:..:.|.:|.
Mouse    71 SEKESQTIQSTLEQHKIHYEILIHDLQEEIEKQF------DVKDEIAGRHSYAKYNDWDKIVSWT 129

  Fly   190 KKLAETHPE-VLLVELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLV 253
            :|:.|.||| |..:::|.:.:..|:..::|...:..|..:|::.||||||||:||...:.:.|..
Mouse   130 EKMLEKHPEMVSRIKIGSTVEDNPLYVLKIGKKDGERKAIFMDCGIHAREWISPAFCQWFVYQAT 194

  Fly   254 NS--KDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNRA--LFGICRGVDLNRNFPFHWN 314
            .|  |:..:..|.....:|:.|..|.|||.:::..||||||||:  ....|.|.||||||...|:
Mouse   195 KSYGKNKIMTKLLDRMNFYVLPVFNVDGYIWSWTQDRMWRKNRSRNQNSTCIGTDLNRNFDVSWD 259

  Fly   315 VTGASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVD 379
            .:..:..||...|.||:..||.||:.:..|||..:.|  |:.:|:.||||||::.|||::.:...
Mouse   260 SSPNTNKPCLNVYRGPAPESEKETKAVTNFIRSHLNS--IKAYITFHSYSQMLLIPYGYTFKLPP 322

  Fly   380 NYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSE 444
            |:.||..:.::|.:.:.......|..|.|..|||.:||.|.||.: .|.|..||::|||....|.
Mouse   323 NHQDLLKVARIATDALSTRYETRYIYGPIASTIYKTSGSSLDWVY-DLGIKHTFAFELRDKGKSG 386

  Fly   445 DLFILSAKEIEPTAAEAFASIQTIVQ 470
              |:|....|:||..|...|::.|.:
Mouse   387 --FLLPESRIKPTCKETMLSVKFIAK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 12/77 (16%)
M14_CP_A-B_like 179..472 CDD:199844 106/297 (36%)
Cpa3NP_031779.1 Propep_M14 28..102 CDD:280416 12/77 (16%)
Peptidase_M14_like 114..413 CDD:299699 106/302 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.