DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and CG43235

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001245931.1 Gene:CG43235 / 12798301 FlyBaseID:FBgn0262880 Length:103 Species:Drosophila melanogaster


Alignment Length:86 Identity:19/86 - (22%)
Similarity:39/86 - (45%) Gaps:4/86 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ADSVQAR-YDHTRIYQVELASEEHVRLFQALEQASDSCSFMGHARQPGQKLTIMVTGAKVADFDD 137
            :|.:..| |::..:|:|.:.:....::...|.:.:|:.:......   ..:.|||:..:...|..
  Fly    19 SDPIGPRSYENYSVYKVFIKTRSDQQVIDGLLKDTDNYNLWHRGL---NVVHIMVSPVEKDSFLA 80

  Fly   138 LVHSYNVTHRVLNYNFQALID 158
            ::...|:...||..|.|.|||
  Fly    81 VMQKENIVVEVLIKNVQTLID 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 15/71 (21%)
M14_CP_A-B_like 179..472 CDD:199844
CG43235NP_001245931.1 Propep_M14 34..102 CDD:280416 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.