DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and LOC105947369

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:XP_012818774.2 Gene:LOC105947369 / 105947369 -ID:- Length:419 Species:Xenopus tropicalis


Alignment Length:418 Identity:133/418 - (31%)
Similarity:212/418 - (50%) Gaps:43/418 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RYDHTRIYQVELASEEHVRLFQALEQASD-------SCSFM-------GHARQPGQKLTIMVTGA 130
            |:|:.:..:|...:||.|:..:.|.:...       |.|::       .||......:   :|| 
 Frog    21 RFDNEKALRVFPQNEEDVQFIKHLARVMQLNFWKPHSSSYVIPKAFVDFHANAEDSHI---ITG- 81

  Fly   131 KVADFDDLVHSYNVTHRVLNYNFQALIDANYLEVA--PEDTKPEEFDWKRYHPLESINAWLKKLA 193
                   |:....:.||:|..|.|..|: |.|..|  |:|   |.|...||.....|:.|..:::
 Frog    82 -------LLEEKGIKHRILFQNLQEAIE-NQLSKAGNPKD---ERFPSPRYRTWLEISTWAYRVS 135

  Fly   194 ETHPE-VLLVELGVSAQGRPILGVQIAFDNENRTTVFVESGIHAREWIAPATATYIIDQLVNS-- 255
            ..:|. |.:|:.|.:.:|:.||.:::...:.::..:.:|.|:||||||:||...:.:::.:.|  
 Frog   136 VKYPNLVSVVQAGNTYEGQTILVLKVGSQSAHKKGIVLECGVHAREWISPAFCQWFVNEAIRSYG 200

  Fly   256 KDSAVQALARSQRWYIFPTVNPDGYQYTFKGDRMWRKNR--ALFGICRGVDLNRNFPFHWNVTGA 318
            ||.|:..|..|..:::.|..|.|||.:|:..||||||||  .....|.||||||||...|. ||.
 Frog   201 KDKAMTKLLNSVTFHVVPVFNVDGYIWTWTHDRMWRKNRYQDANNKCVGVDLNRNFNASWG-TGF 264

  Fly   319 SGD-PCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTFISLHSYSQMIMFPYGHSAERVDNYH 382
            |.| ||...|:|....||.||:.:..:||..:.|  ::.:||.|:|.||:|:|||:.:|:..|..
 Frog   265 SNDEPCSEIYAGSGPESENETKAVASYIRDNISS--LKAYISFHAYGQMLMYPYGYKSEKPPNSK 327

  Fly   383 DLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDWAHGQLKIPITFSYELRGPADSEDLF 447
            .|..|...|...:..:.|..|..|.|..||||.||.|.|||:.: .:..:|::|||.  :.:..|
 Frog   328 KLDKIAVSALKALSTLYGTSYTHGPIATTIYPVSGSSIDWAYDE-GMKYSFAFELRD--EGQYGF 389

  Fly   448 ILSAKEIEPTAAEAFASIQTIVQEAGKR 475
            :|...:|:.|..|...:::.|.:....|
 Frog   390 LLPENQIKKTCMETMLAVKAIAKSVVTR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416 18/84 (21%)
M14_CP_A-B_like 179..472 CDD:199844 104/298 (35%)
LOC105947369XP_012818774.2 Propep_M14 33..104 CDD:366995 17/82 (21%)
Peptidase_M14_like 116..415 CDD:386095 106/304 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.