DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4408 and cpo

DIOPT Version :9

Sequence 1:NP_651141.2 Gene:CG4408 / 42762 FlyBaseID:FBgn0039073 Length:479 Species:Drosophila melanogaster
Sequence 2:NP_001139101.1 Gene:cpo / 100005630 ZFINID:ZDB-GENE-070619-6 Length:363 Species:Danio rerio


Alignment Length:307 Identity:106/307 - (34%)
Similarity:180/307 - (58%) Gaps:14/307 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 EEFDWKRYHPLESINAWLKKLAETHPEVL-LVELGVSAQGRPILGVQIAFDNEN-RTTVFVESGI 234
            :.:|:.:||.::.|:||:.::...:|:|: .:..|.:.:.|.|..::|.|.:.. :..::::.||
Zfish    28 KSYDYTKYHTMDEISAWMNQMQRENPDVVSTMTYGQTYEKRNITLLKIGFSSTTPKKAIWMDCGI 92

  Fly   235 HAREWIAPATATYIIDQLVNS--KDSAVQALARSQRWYIFPTVNPDGYQYTF--KGDRMWRKNRA 295
            |||||||||...:.:.:::.|  .||.|..|.::..:||.|.:|.|||.|::  ...|:|||:|:
Zfish    93 HAREWIAPAFCQHFVKEVLGSYKTDSRVNMLFKNLDFYITPVLNMDGYIYSWLNNSTRLWRKSRS 157

  Fly   296 LF---GICRGVDLNRNFPFHWNVTGASGDPCRYDYSGPSAASEVETQRMIEFIRHRVESERIRTF 357
            ..   ..|.|.||||||..:|.:.|.|.:.|...|:|.:|.||.|.:.:.:|:  ......:..:
Zfish   158 PCHENSTCSGTDLNRNFYANWGMVGISRNCCSEVYNGATALSEPEAEAVTDFL--GAHQNHLLCY 220

  Fly   358 ISLHSYSQMIMFPYGHSAERVDNYHDLTDIGKLAANKIKDVSGRIYKSGSIYETIYPSSGGSKDW 422
            :::|||.|:|:.||||......||.:|.::|..||..||.|.|:.||.||..:.:||:||.|:|:
Zfish   221 LTIHSYGQLILVPYGHPNISAPNYDELMEVGLAAAKAIKAVHGKSYKVGSSPDVLYPNSGSSRDF 285

  Fly   423 AHGQLKIPITFSYELRGPADSEDLFILSAKEIEPTAAEAFASIQTIV 469
            |. .:.||.:|::|||.  :.:..|||...:|:||..||:....:|:
Zfish   286 AR-LIGIPYSFTFELRD--EGQHGFILPEDQIQPTCQEAYEGAMSII 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4408NP_651141.2 Propep_M14 88..159 CDD:280416
M14_CP_A-B_like 179..472 CDD:199844 105/300 (35%)
cpoNP_001139101.1 M14_CP_A-B_like 35..332 CDD:199844 105/300 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.