DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS3 and AT2G31610

DIOPT Version :9

Sequence 1:NP_001287481.1 Gene:RpS3 / 42761 FlyBaseID:FBgn0002622 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_180719.1 Gene:AT2G31610 / 817719 AraportID:AT2G31610 Length:250 Species:Arabidopsis thaliana


Alignment Length:218 Identity:164/218 - (75%)
Similarity:183/218 - (83%) Gaps:0/218 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ISKKRKFVSDGIFKAELNEFLTRELAEDGYSGVEVRVTPSRTEIIIMATKTQQVLGEKGRRIREL 71
            ||||||||:||:|.|||||.|||||||||||||||||||.||||||.||:||.||||||||||||
plant     5 ISKKRKFVADGVFYAELNEVLTRELAEDGYSGVEVRVTPMRTEIIIRATRTQNVLGEKGRRIREL 69

  Fly    72 TAMVQKRFNFETGRIELYAEKVAARGLCAIAQAESLRYKLTGGLAVRRACYGVLRYIMESGAKGC 136
            |::|||||.|....:|||||||..||||||||||||||||.||||||||||||||::||||||||
plant    70 TSLVQKRFKFPVDSVELYAEKVNNRGLCAIAQAESLRYKLLGGLAVRRACYGVLRFVMESGAKGC 134

  Fly   137 EVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVETATRHVLLRQGVLGIKVKVMLPYDPKNKIG 201
            ||:||||||..|||||||.||.|:.||.|..:|::.|.|||||||||||||||:||.:||..|.|
plant   135 EVIVSGKLRAARAKSMKFKDGYMVSSGQPTKEYIDAAVRHVLLRQGVLGIKVKIMLDWDPTGKSG 199

  Fly   202 PKKPLPDNVSVVEPKEEKIYETP 224
            ||.||||.|.:..||::.:|..|
plant   200 PKTPLPDVVIIHAPKDDVVYSAP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS3NP_001287481.1 PTZ00084 6..222 CDD:240260 162/214 (76%)
AT2G31610NP_180719.1 PTZ00084 3..220 CDD:240260 162/214 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 137 1.000 Domainoid score I1582
eggNOG 1 0.900 - - E1_COG0092
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H779
Inparanoid 1 1.050 331 1.000 Inparanoid score I675
OMA 1 1.010 - - QHG60603
OrthoDB 1 1.010 - - D1135751at2759
OrthoFinder 1 1.000 - - FOG0001904
OrthoInspector 1 1.000 - - otm3315
orthoMCL 1 0.900 - - OOG6_100514
Panther 1 1.100 - - O PTHR11760
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2144
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.